PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_019193-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB_related
Protein Properties Length: 384aa    MW: 41902.5 Da    PI: 7.0699
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_019193-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding38.23.4e-12150194347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+  ++ + ++lG+g+W+ Iar     Rt+ q+ s+ qky
    NNU_019193-RA 150 PWTEEEHRMFLLGLQKLGKGDWRGIARNYVISRTPTQVASHAQKY 194
                      8*****************************89************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129419.939143199IPR017930Myb domain
SuperFamilySSF466899.33E-17145200IPR009057Homeodomain-like
TIGRFAMsTIGR015572.8E-19146198IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.603.5E-11147193IPR009057Homeodomain-like
SMARTSM007178.0E-11147197IPR001005SANT/Myb domain
PfamPF002491.3E-10150194IPR001005SANT/Myb domain
CDDcd001673.55E-9150195No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000122Biological Processnegative regulation of transcription from RNA polymerase II promoter
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0030307Biological Processpositive regulation of cell growth
GO:0046686Biological Processresponse to cadmium ion
GO:0048366Biological Processleaf development
GO:2000469Biological Processnegative regulation of peroxidase activity
GO:0000976Molecular Functiontranscription regulatory region sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 384 aa     Download sequence    Send to blast
MIGFKLISGL FEALTLTLNF LFSFFYYKFG SRVSSLEEGN QPVGGREAGG EEEMTRRCSH  60
CSHNGHNSRT CPNRGVKLFG VRLTDGSIRK SASMGNLTHY TGSSSNNHHH NNTPGSPGET  120
PEHGAAADGY ASEDFVQGSS SCRERKKGVP WTEEEHRMFL LGLQKLGKGD WRGIARNYVI  180
SRTPTQVASH AQKYFIRQSN VSRRKRRSSL FDIIADETVD TPSAQELLPT SHPQAETQSN  240
NPLPVPTALD EECESMDSTN SNDGEPAPPK PESTQSSYPV IFPAYFSPFF PFSFPFWPGY  300
TAEATTKETH EVVKPTAIHS KSPINVDELV GMSKLSLGES LGNSGPSSLS LKLLEGSTRQ  360
SAFHAKPATG PSSMDTSSNP IHAV
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00551DAPTransfer from AT5G47390Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010275370.10.0PREDICTED: transcription factor MYB1R1-like
TrEMBLA0A067FDS70.0A0A067FDS7_CITSI; Uncharacterized protein
STRINGPOPTR_0001s15510.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47390.11e-105MYB_related family protein